![\"domain](\"https:\/\/elyspace.com\/blog\/wp-content\/uploads\/2026\/08\/why_domain_matters_hero_illustration-1024x576.png\")
<\/figure>\n\n\n\nYour domain name is the first handshake between your business and a stranger on the internet. Before they see your products, your prices, or your service, they see your web address. If it looks sloppy or hard to trust, they bounce. If it looks clean and local, they stay a little longer.<\/p>\n\n\n\n
For a Kashmir business, this matters even more. You’re often competing against bigger players from Delhi or Mumbai who have more marketing budget but less local trust. A domain name that feels rooted, professional, and easy to remember does some of that trust-building work for you, before a single sale happens.<\/p>\n\n\n\n
There’s also a practical side nobody talks about enough. Once your domain is indexed by Google, tied to your GST registration, printed on your visiting cards, and shared across WhatsApp groups, changing it means starting your search visibility from scratch. That’s not a small cost. That’s months of lost ranking.<\/p>\n\n\n\n
Start With Your Business Name, Not a Keyword<\/strong><\/h2>\n\n\n\n![\"domain](\"https:\/\/elyspace.com\/blog\/wp-content\/uploads\/2026\/08\/business_name_vs_keyword_hero_illustration-1024x576.png\")
<\/figure>\n\n\n\nA lot of guides will tell you to stuff your domain with keywords like “besthandicraftskashmir.com” because it sounds good for SEO. Don’t do this. Google stopped rewarding exact-match keyword domains years ago, and honestly, customers find these names forgettable and slightly spammy.<\/p>\n\n\n\n
Your domain should match your actual business name wherever possible. If you run “Valley Crafts Kashmir,” your domain should be valleycraftskashmir.com, not “buypashminaonlinekashmir.com.” A domain name for your Kashmir business needs to represent your brand first. The SEO benefit of a keyword-stuffed domain is small and shrinking, while the brand cost of a clunky name is permanent.<\/p>\n\n\n\n
Keep It Short. Seriously, Shorter Than You Think<\/strong><\/h2>\n\n\n\n![\"domain](\"https:\/\/elyspace.com\/blog\/wp-content\/uploads\/2026\/08\/keep_it_short_hero_illustration-1024x576.png\")
<\/figure>\n\n\n\nEvery extra syllable is a chance for someone to mistype your web address or forget it entirely. Aim for something a customer can hear once on a phone call and type correctly without asking you to repeat it.<\/p>\n\n\n\n
A rough rule that’s served small businesses well: if your domain name takes more than three seconds to say out loud, it’s probably too long. Compare “kashmirvalleyhandicraftsandgifts.com” with “valleycrafts.com.” The second one wins every single time, in memory, in trust, and in how it looks on a signboard or an invoice.<\/p>\n\n\n\n
Choosing the Right Extension for a Kashmir Business<\/strong><\/h2>\n\n\n\nThe extension, or TLD, is the part after the dot: .com, .in, .co.in, and so on. Here’s how to think about it practically.<\/p>\n\n\n\n
.com<\/strong> is still the global default. If your customers include people outside Jammu and Kashmir, or you plan to sell nationally or internationally down the line, go with .com if it’s available.<\/p>\n\n\n\n.in<\/strong> works well if your business is explicitly India-focused and the .com version of your name is already taken. It also tends to be cheaper to renew.<\/p>\n\n\n\n.co.in<\/strong> is a decent fallback, though it carries slightly less trust than .com or .in in a buyer’s mind, mainly because it’s less common.<\/p>\n\n\n\nAvoid unusual extensions like .xyz or .info for a serious business unless you have a very specific reason. They’re cheaper, but they can quietly signal “not fully established” to a first-time visitor, even if that’s unfair.<\/p>\n\n\n\n
Avoid Hyphens, Numbers, and Confusing Spellings<\/strong><\/h2>\n\n\n\nThis one trips up more Kashmiri businesses than any other mistake on this list. If your ideal domain is taken, resist the urge to add a hyphen (valley-crafts.com) or swap a letter for a number (valley4crafts.com). Both create real problems.<\/p>\n\n\n\n
Hyphens get lost when someone reads your domain out loud or types it from memory. Numbers create ambiguity, since nobody knows if you meant the digit “4” or the word “four.” Either choice quietly leaks traffic to a competitor who registered the cleaner version, or worse, to a scam site squatting on the confusing spelling.<\/p>\n\n\n\n
If your first choice is taken, it’s almost always better to slightly rework the business name itself than to bolt on a hyphen or number to force the domain through.<\/p>\n\n\n\n
Should You Use “Kashmir” or Your City in the Domain?<\/strong><\/h2>\n\n\n\nThis depends entirely on who you’re selling to.<\/p>\n\n\n\n
If your business genuinely serves a local, geography-specific audience, a tour operator, a local delivery service, a Srinagar-based repair shop, then including “Kashmir” or your city name can actually help. Customers searching “houseboat booking Kashmir” or “AC repair Srinagar” respond well to a domain that mirrors their search.<\/p>\n\n\n\n
If you’re building a brand that could eventually expand beyond the region, a Pashmina label that wants to sell in Delhi and Dubai, a software product, a design studio, lean toward a name that isn’t geographically locked in. “Kashmir” in the domain becomes a limitation the moment you outgrow it.<\/p>\n\n\n\n
There’s no universally right answer here. It genuinely comes down to whether your five-year plan is regional or national.<\/p>\n\n\n\n
Check for Trademarks Before You Fall in Love With a Name<\/strong><\/h2>\n\n\n\nThis step gets skipped constantly, and it’s the one that causes real legal headaches later. Before you register anything, run a quick search on India’s official trademark database through the Controller General of Patents, Designs and Trade Marks<\/a> to make sure your proposed name isn’t already trademarked in your business category.<\/p>\n\n\n\nI’ve seen a small apparel brand in Kashmir spend two years building a following under a name, only to receive a legal notice because a larger company held the trademark in a different state. They had to rebrand, redo their signage, reprint packaging, and start their domain authority over. A ten-minute search at the start would have avoided all of it.<\/p>\n\n\n\n
Secure Your Social Handles Alongside the Domain<\/strong><\/h2>\n\n\n\nOnce you’ve shortlisted a domain, check Instagram, Facebook, and WhatsApp Business for the same name before you register anything. Consistency across your domain and your social handles makes your business look established and makes it dramatically easier for customers to find and remember you.<\/p>\n\n\n\n
If the exact name is taken on Instagram but the domain is free, or vice versa, that’s usually a signal to keep looking rather than settling for a mismatched setup that confuses people later.<\/p>\n\n\n\n
Think About How It Sounds, Not Just How It Reads<\/strong><\/h2>\n\n\n\nKashmir runs on word of mouth. A customer tells their cousin, their cousin tells a shopkeeper, and eventually someone types your domain from memory, not from a screenshot. So read your shortlisted names out loud to a few people who’ve never seen them written down. Ask them to spell it back to you.<\/p>\n\n\n\n
If two or three people misspell it the same way, that’s not bad luck. That’s a naming problem, and it’s worth fixing before you commit rather than after you’ve printed a thousand business cards.<\/p>\n\n\n\n
Register Multiple Extensions to Protect Your Brand<\/strong><\/h2>\n\n\n\nIf your budget allows, register the .com, .in, and .co.in versions of your chosen name even if you only plan to actively use one. This is standard practice for a reason. It stops competitors or opportunists from registering a near-identical version of your domain and either confusing your customers or, worse, redirecting your traffic to their own site.<\/p>\n\n\n\n
You don’t need to build separate websites on each one. Just point the extras to your main site, or park them, so they’re sitting quietly under your control instead of someone else’s.<\/p>\n\n\n\n
Common Mistakes Kashmiri Businesses Make<\/strong><\/h2>\n\n\n\nA few patterns show up again and again in this region specifically:<\/p>\n\n\n\n
Picking a name that’s identical to an existing hosting or handicraft business, just with the city name swapped, which creates constant customer confusion. Registering a domain through an unfamiliar, unverified reseller and losing access to it later because the account details were never properly transferred. Choosing a name in Urdu transliteration that has three or four different possible English spellings, splitting search traffic across all of them. And the most common one: registering the domain and then forgetting to renew it a year later, only to find it’s been bought by someone else within days of expiry.<\/p>\n\n\n\n
Each of these is avoidable with about twenty minutes of upfront planning.<\/p>\n\n\n\n
How a Domain Name Affects Your SEO<\/strong><\/h2>\n\n\n\nLet’s be direct about this, since a lot of guides oversell it. Your domain name itself is a small SEO factor today, not the huge one it used to be in 2010. Google’s own Search Central documentation<\/a> is clear that content quality, site structure, and genuine relevance to a searcher’s query matter far more than whatever string sits before the dot-com.<\/p>\n\n\n\nThat said, a clean, brand-matched domain name for your Kashmir business still helps indirectly. It improves click-through rates in search results because people trust a clear name more than a cluttered one. It reduces bounce because visitors immediately understand where they’ve landed. And it makes your backlink profile look more natural over time, since other sites are more likely to link to a name that’s easy to reference and credible.<\/p>\n\n\n\n
In short: don’t pick a domain hoping it’ll single-handedly rank you on page one. Pick it because it builds the trust and clarity that makes everything else you do for SEO actually work.<\/p>\n\n\n\n
Where to Register Your Domain<\/strong><\/h2>\n\n\n\nOnce you’ve settled on a name and extension, register it through a provider that’s actually familiar with Kashmir’s business landscape, not just a generic reseller panel. Local support matters more than people expect, especially when you need quick help with DNS records, email setup, or connecting your domain to hosting.<\/p>\n\n\n\n
ElySpace<\/a>, based in Srinagar, handles domain registration alongside hosting, SSL certificates, and WordPress setup for businesses across the valley, so your domain and your website end up managed in one place instead of scattered across three different logins you’ll forget about. If you want a deeper look at how local registrars compare, ElySpace also has a detailed breakdown of domain registration options in Kashmir<\/a> worth reading before you commit.<\/p>\n\n\n\nFrequently Asked Questions<\/strong><\/h2>\n\n\n\nIs .com always better than .in for a Kashmir business?<\/strong> Not always. If you’re strictly local and .com isn’t available, a clean .in domain works fine. What matters more is that the name itself is short and easy to spell.<\/p>\n\n\n\nCan I change my domain name later if I pick the wrong one?<\/strong> You can, but it costs you search rankings, backlinks, and brand recognition built under the old name. It’s far cheaper to get it right the first time than to migrate later.<\/p>\n\n\n\nShould I include my product or service in the domain name?<\/strong> Only if it doesn’t force the name to become long or awkward. A brand name that stands on its own usually ages better than one locked to a single product you might expand beyond.<\/p>\n\n\n\nHow much does domain registration typically cost?<\/strong> Standard .com and .in domains usually run a modest yearly renewal fee, varying by registrar. Always check what the renewal price is after the first year, since some providers offer a low first-year rate and a much higher renewal.<\/p>\n\n\n\nDo I need hosting and a domain from the same company?<\/strong> No, they can be separate, but managing both through one reliable provider tends to save time and reduces the chance of technical mix-ups when connecting the two.<\/p>\n\n\n\n
\n\n\n\nConclusion<\/strong><\/h2>\n\n\n\nYour domain name isn’t just an address. It’s the first line of trust you’re building with every single customer who hasn’t met you yet. Take the extra hour. Check the trademark. Say the name out loud to someone who’s never heard it. Then register it, lock in your renewal reminder, and go build the business that name deserves.<\/p>\n","protected":false},"excerpt":{"rendered":"
If you’re starting a business in Srinagar, Anantnag, Baramulla, or anywhere else in the valley, there’s a decision sitting right at the start of your journey that most people rush through in five minutes: your domain name. And that’s a shame, because the domain name for your Kashmir business is one of the few things […]<\/p>\n","protected":false},"author":12,"featured_media":5649,"comment_status":"open","ping_status":"closed","sticky":false,"template":"","format":"standard","meta":{"_acf_changed":false,"footnotes":""},"categories":[20,19,6],"tags":[848,852,847,851,833,846,850,829,330,845,165,849,835,853],"class_list":["post-5648","post","type-post","status-publish","format-standard","has-post-thumbnail","hentry","category-domain-name","category-startups","category-tutorials","tag-com-vs-in-domain","tag-business-domain-name-tips","tag-buy-domain-online","tag-choose-a-domain-name","tag-domain-name","tag-domain-name-for-your-kashmir-business","tag-domain-name-seo","tag-domain-registration","tag-elyspace","tag-kashmir-business","tag-small-business-website","tag-srinagar-business","tag-web-hosting-kashmir","tag-website-domain-registration-india"],"acf":[],"_links":{"self":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts"}],"about":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/types\/post"}],"author":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/users\/12"}],"replies":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/comments?post=5648"}],"version-history":[{"count":2,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions"}],"predecessor-version":[{"id":5662,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions\/5662"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media\/5649"}],"wp:attachment":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media?parent=5648"}],"wp:term":[{"taxonomy":"category","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/categories?post=5648"},{"taxonomy":"post_tag","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/tags?post=5648"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}
<\/figure>\n\n\n\nA lot of guides will tell you to stuff your domain with keywords like “besthandicraftskashmir.com” because it sounds good for SEO. Don’t do this. Google stopped rewarding exact-match keyword domains years ago, and honestly, customers find these names forgettable and slightly spammy.<\/p>\n\n\n\n
Your domain should match your actual business name wherever possible. If you run “Valley Crafts Kashmir,” your domain should be valleycraftskashmir.com, not “buypashminaonlinekashmir.com.” A domain name for your Kashmir business needs to represent your brand first. The SEO benefit of a keyword-stuffed domain is small and shrinking, while the brand cost of a clunky name is permanent.<\/p>\n\n\n\n
Keep It Short. Seriously, Shorter Than You Think<\/strong><\/h2>\n\n\n\n<\/figure>\n\n\n\nEvery extra syllable is a chance for someone to mistype your web address or forget it entirely. Aim for something a customer can hear once on a phone call and type correctly without asking you to repeat it.<\/p>\n\n\n\n
A rough rule that’s served small businesses well: if your domain name takes more than three seconds to say out loud, it’s probably too long. Compare “kashmirvalleyhandicraftsandgifts.com” with “valleycrafts.com.” The second one wins every single time, in memory, in trust, and in how it looks on a signboard or an invoice.<\/p>\n\n\n\n
Choosing the Right Extension for a Kashmir Business<\/strong><\/h2>\n\n\n\nThe extension, or TLD, is the part after the dot: .com, .in, .co.in, and so on. Here’s how to think about it practically.<\/p>\n\n\n\n
.com<\/strong> is still the global default. If your customers include people outside Jammu and Kashmir, or you plan to sell nationally or internationally down the line, go with .com if it’s available.<\/p>\n\n\n\n.in<\/strong> works well if your business is explicitly India-focused and the .com version of your name is already taken. It also tends to be cheaper to renew.<\/p>\n\n\n\n.co.in<\/strong> is a decent fallback, though it carries slightly less trust than .com or .in in a buyer’s mind, mainly because it’s less common.<\/p>\n\n\n\nAvoid unusual extensions like .xyz or .info for a serious business unless you have a very specific reason. They’re cheaper, but they can quietly signal “not fully established” to a first-time visitor, even if that’s unfair.<\/p>\n\n\n\n
Avoid Hyphens, Numbers, and Confusing Spellings<\/strong><\/h2>\n\n\n\nThis one trips up more Kashmiri businesses than any other mistake on this list. If your ideal domain is taken, resist the urge to add a hyphen (valley-crafts.com) or swap a letter for a number (valley4crafts.com). Both create real problems.<\/p>\n\n\n\n
Hyphens get lost when someone reads your domain out loud or types it from memory. Numbers create ambiguity, since nobody knows if you meant the digit “4” or the word “four.” Either choice quietly leaks traffic to a competitor who registered the cleaner version, or worse, to a scam site squatting on the confusing spelling.<\/p>\n\n\n\n
If your first choice is taken, it’s almost always better to slightly rework the business name itself than to bolt on a hyphen or number to force the domain through.<\/p>\n\n\n\n
Should You Use “Kashmir” or Your City in the Domain?<\/strong><\/h2>\n\n\n\nThis depends entirely on who you’re selling to.<\/p>\n\n\n\n
If your business genuinely serves a local, geography-specific audience, a tour operator, a local delivery service, a Srinagar-based repair shop, then including “Kashmir” or your city name can actually help. Customers searching “houseboat booking Kashmir” or “AC repair Srinagar” respond well to a domain that mirrors their search.<\/p>\n\n\n\n
If you’re building a brand that could eventually expand beyond the region, a Pashmina label that wants to sell in Delhi and Dubai, a software product, a design studio, lean toward a name that isn’t geographically locked in. “Kashmir” in the domain becomes a limitation the moment you outgrow it.<\/p>\n\n\n\n
There’s no universally right answer here. It genuinely comes down to whether your five-year plan is regional or national.<\/p>\n\n\n\n
Check for Trademarks Before You Fall in Love With a Name<\/strong><\/h2>\n\n\n\nThis step gets skipped constantly, and it’s the one that causes real legal headaches later. Before you register anything, run a quick search on India’s official trademark database through the Controller General of Patents, Designs and Trade Marks<\/a> to make sure your proposed name isn’t already trademarked in your business category.<\/p>\n\n\n\nI’ve seen a small apparel brand in Kashmir spend two years building a following under a name, only to receive a legal notice because a larger company held the trademark in a different state. They had to rebrand, redo their signage, reprint packaging, and start their domain authority over. A ten-minute search at the start would have avoided all of it.<\/p>\n\n\n\n
Secure Your Social Handles Alongside the Domain<\/strong><\/h2>\n\n\n\nOnce you’ve shortlisted a domain, check Instagram, Facebook, and WhatsApp Business for the same name before you register anything. Consistency across your domain and your social handles makes your business look established and makes it dramatically easier for customers to find and remember you.<\/p>\n\n\n\n
If the exact name is taken on Instagram but the domain is free, or vice versa, that’s usually a signal to keep looking rather than settling for a mismatched setup that confuses people later.<\/p>\n\n\n\n
Think About How It Sounds, Not Just How It Reads<\/strong><\/h2>\n\n\n\nKashmir runs on word of mouth. A customer tells their cousin, their cousin tells a shopkeeper, and eventually someone types your domain from memory, not from a screenshot. So read your shortlisted names out loud to a few people who’ve never seen them written down. Ask them to spell it back to you.<\/p>\n\n\n\n
If two or three people misspell it the same way, that’s not bad luck. That’s a naming problem, and it’s worth fixing before you commit rather than after you’ve printed a thousand business cards.<\/p>\n\n\n\n
Register Multiple Extensions to Protect Your Brand<\/strong><\/h2>\n\n\n\nIf your budget allows, register the .com, .in, and .co.in versions of your chosen name even if you only plan to actively use one. This is standard practice for a reason. It stops competitors or opportunists from registering a near-identical version of your domain and either confusing your customers or, worse, redirecting your traffic to their own site.<\/p>\n\n\n\n
You don’t need to build separate websites on each one. Just point the extras to your main site, or park them, so they’re sitting quietly under your control instead of someone else’s.<\/p>\n\n\n\n
Common Mistakes Kashmiri Businesses Make<\/strong><\/h2>\n\n\n\nA few patterns show up again and again in this region specifically:<\/p>\n\n\n\n
Picking a name that’s identical to an existing hosting or handicraft business, just with the city name swapped, which creates constant customer confusion. Registering a domain through an unfamiliar, unverified reseller and losing access to it later because the account details were never properly transferred. Choosing a name in Urdu transliteration that has three or four different possible English spellings, splitting search traffic across all of them. And the most common one: registering the domain and then forgetting to renew it a year later, only to find it’s been bought by someone else within days of expiry.<\/p>\n\n\n\n
Each of these is avoidable with about twenty minutes of upfront planning.<\/p>\n\n\n\n
How a Domain Name Affects Your SEO<\/strong><\/h2>\n\n\n\nLet’s be direct about this, since a lot of guides oversell it. Your domain name itself is a small SEO factor today, not the huge one it used to be in 2010. Google’s own Search Central documentation<\/a> is clear that content quality, site structure, and genuine relevance to a searcher’s query matter far more than whatever string sits before the dot-com.<\/p>\n\n\n\nThat said, a clean, brand-matched domain name for your Kashmir business still helps indirectly. It improves click-through rates in search results because people trust a clear name more than a cluttered one. It reduces bounce because visitors immediately understand where they’ve landed. And it makes your backlink profile look more natural over time, since other sites are more likely to link to a name that’s easy to reference and credible.<\/p>\n\n\n\n
In short: don’t pick a domain hoping it’ll single-handedly rank you on page one. Pick it because it builds the trust and clarity that makes everything else you do for SEO actually work.<\/p>\n\n\n\n
Where to Register Your Domain<\/strong><\/h2>\n\n\n\nOnce you’ve settled on a name and extension, register it through a provider that’s actually familiar with Kashmir’s business landscape, not just a generic reseller panel. Local support matters more than people expect, especially when you need quick help with DNS records, email setup, or connecting your domain to hosting.<\/p>\n\n\n\n
ElySpace<\/a>, based in Srinagar, handles domain registration alongside hosting, SSL certificates, and WordPress setup for businesses across the valley, so your domain and your website end up managed in one place instead of scattered across three different logins you’ll forget about. If you want a deeper look at how local registrars compare, ElySpace also has a detailed breakdown of domain registration options in Kashmir<\/a> worth reading before you commit.<\/p>\n\n\n\nFrequently Asked Questions<\/strong><\/h2>\n\n\n\nIs .com always better than .in for a Kashmir business?<\/strong> Not always. If you’re strictly local and .com isn’t available, a clean .in domain works fine. What matters more is that the name itself is short and easy to spell.<\/p>\n\n\n\nCan I change my domain name later if I pick the wrong one?<\/strong> You can, but it costs you search rankings, backlinks, and brand recognition built under the old name. It’s far cheaper to get it right the first time than to migrate later.<\/p>\n\n\n\nShould I include my product or service in the domain name?<\/strong> Only if it doesn’t force the name to become long or awkward. A brand name that stands on its own usually ages better than one locked to a single product you might expand beyond.<\/p>\n\n\n\nHow much does domain registration typically cost?<\/strong> Standard .com and .in domains usually run a modest yearly renewal fee, varying by registrar. Always check what the renewal price is after the first year, since some providers offer a low first-year rate and a much higher renewal.<\/p>\n\n\n\nDo I need hosting and a domain from the same company?<\/strong> No, they can be separate, but managing both through one reliable provider tends to save time and reduces the chance of technical mix-ups when connecting the two.<\/p>\n\n\n\n
\n\n\n\nConclusion<\/strong><\/h2>\n\n\n\nYour domain name isn’t just an address. It’s the first line of trust you’re building with every single customer who hasn’t met you yet. Take the extra hour. Check the trademark. Say the name out loud to someone who’s never heard it. Then register it, lock in your renewal reminder, and go build the business that name deserves.<\/p>\n","protected":false},"excerpt":{"rendered":"
If you’re starting a business in Srinagar, Anantnag, Baramulla, or anywhere else in the valley, there’s a decision sitting right at the start of your journey that most people rush through in five minutes: your domain name. And that’s a shame, because the domain name for your Kashmir business is one of the few things […]<\/p>\n","protected":false},"author":12,"featured_media":5649,"comment_status":"open","ping_status":"closed","sticky":false,"template":"","format":"standard","meta":{"_acf_changed":false,"footnotes":""},"categories":[20,19,6],"tags":[848,852,847,851,833,846,850,829,330,845,165,849,835,853],"class_list":["post-5648","post","type-post","status-publish","format-standard","has-post-thumbnail","hentry","category-domain-name","category-startups","category-tutorials","tag-com-vs-in-domain","tag-business-domain-name-tips","tag-buy-domain-online","tag-choose-a-domain-name","tag-domain-name","tag-domain-name-for-your-kashmir-business","tag-domain-name-seo","tag-domain-registration","tag-elyspace","tag-kashmir-business","tag-small-business-website","tag-srinagar-business","tag-web-hosting-kashmir","tag-website-domain-registration-india"],"acf":[],"_links":{"self":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts"}],"about":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/types\/post"}],"author":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/users\/12"}],"replies":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/comments?post=5648"}],"version-history":[{"count":2,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions"}],"predecessor-version":[{"id":5662,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions\/5662"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media\/5649"}],"wp:attachment":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media?parent=5648"}],"wp:term":[{"taxonomy":"category","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/categories?post=5648"},{"taxonomy":"post_tag","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/tags?post=5648"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}
<\/figure>\n\n\n\nEvery extra syllable is a chance for someone to mistype your web address or forget it entirely. Aim for something a customer can hear once on a phone call and type correctly without asking you to repeat it.<\/p>\n\n\n\n
A rough rule that’s served small businesses well: if your domain name takes more than three seconds to say out loud, it’s probably too long. Compare “kashmirvalleyhandicraftsandgifts.com” with “valleycrafts.com.” The second one wins every single time, in memory, in trust, and in how it looks on a signboard or an invoice.<\/p>\n\n\n\n
Choosing the Right Extension for a Kashmir Business<\/strong><\/h2>\n\n\n\nThe extension, or TLD, is the part after the dot: .com, .in, .co.in, and so on. Here’s how to think about it practically.<\/p>\n\n\n\n
.com<\/strong> is still the global default. If your customers include people outside Jammu and Kashmir, or you plan to sell nationally or internationally down the line, go with .com if it’s available.<\/p>\n\n\n\n.in<\/strong> works well if your business is explicitly India-focused and the .com version of your name is already taken. It also tends to be cheaper to renew.<\/p>\n\n\n\n.co.in<\/strong> is a decent fallback, though it carries slightly less trust than .com or .in in a buyer’s mind, mainly because it’s less common.<\/p>\n\n\n\nAvoid unusual extensions like .xyz or .info for a serious business unless you have a very specific reason. They’re cheaper, but they can quietly signal “not fully established” to a first-time visitor, even if that’s unfair.<\/p>\n\n\n\n
Avoid Hyphens, Numbers, and Confusing Spellings<\/strong><\/h2>\n\n\n\nThis one trips up more Kashmiri businesses than any other mistake on this list. If your ideal domain is taken, resist the urge to add a hyphen (valley-crafts.com) or swap a letter for a number (valley4crafts.com). Both create real problems.<\/p>\n\n\n\n
Hyphens get lost when someone reads your domain out loud or types it from memory. Numbers create ambiguity, since nobody knows if you meant the digit “4” or the word “four.” Either choice quietly leaks traffic to a competitor who registered the cleaner version, or worse, to a scam site squatting on the confusing spelling.<\/p>\n\n\n\n
If your first choice is taken, it’s almost always better to slightly rework the business name itself than to bolt on a hyphen or number to force the domain through.<\/p>\n\n\n\n
Should You Use “Kashmir” or Your City in the Domain?<\/strong><\/h2>\n\n\n\nThis depends entirely on who you’re selling to.<\/p>\n\n\n\n
If your business genuinely serves a local, geography-specific audience, a tour operator, a local delivery service, a Srinagar-based repair shop, then including “Kashmir” or your city name can actually help. Customers searching “houseboat booking Kashmir” or “AC repair Srinagar” respond well to a domain that mirrors their search.<\/p>\n\n\n\n
If you’re building a brand that could eventually expand beyond the region, a Pashmina label that wants to sell in Delhi and Dubai, a software product, a design studio, lean toward a name that isn’t geographically locked in. “Kashmir” in the domain becomes a limitation the moment you outgrow it.<\/p>\n\n\n\n
There’s no universally right answer here. It genuinely comes down to whether your five-year plan is regional or national.<\/p>\n\n\n\n
Check for Trademarks Before You Fall in Love With a Name<\/strong><\/h2>\n\n\n\nThis step gets skipped constantly, and it’s the one that causes real legal headaches later. Before you register anything, run a quick search on India’s official trademark database through the Controller General of Patents, Designs and Trade Marks<\/a> to make sure your proposed name isn’t already trademarked in your business category.<\/p>\n\n\n\nI’ve seen a small apparel brand in Kashmir spend two years building a following under a name, only to receive a legal notice because a larger company held the trademark in a different state. They had to rebrand, redo their signage, reprint packaging, and start their domain authority over. A ten-minute search at the start would have avoided all of it.<\/p>\n\n\n\n
Secure Your Social Handles Alongside the Domain<\/strong><\/h2>\n\n\n\nOnce you’ve shortlisted a domain, check Instagram, Facebook, and WhatsApp Business for the same name before you register anything. Consistency across your domain and your social handles makes your business look established and makes it dramatically easier for customers to find and remember you.<\/p>\n\n\n\n
If the exact name is taken on Instagram but the domain is free, or vice versa, that’s usually a signal to keep looking rather than settling for a mismatched setup that confuses people later.<\/p>\n\n\n\n
Think About How It Sounds, Not Just How It Reads<\/strong><\/h2>\n\n\n\nKashmir runs on word of mouth. A customer tells their cousin, their cousin tells a shopkeeper, and eventually someone types your domain from memory, not from a screenshot. So read your shortlisted names out loud to a few people who’ve never seen them written down. Ask them to spell it back to you.<\/p>\n\n\n\n
If two or three people misspell it the same way, that’s not bad luck. That’s a naming problem, and it’s worth fixing before you commit rather than after you’ve printed a thousand business cards.<\/p>\n\n\n\n
Register Multiple Extensions to Protect Your Brand<\/strong><\/h2>\n\n\n\nIf your budget allows, register the .com, .in, and .co.in versions of your chosen name even if you only plan to actively use one. This is standard practice for a reason. It stops competitors or opportunists from registering a near-identical version of your domain and either confusing your customers or, worse, redirecting your traffic to their own site.<\/p>\n\n\n\n
You don’t need to build separate websites on each one. Just point the extras to your main site, or park them, so they’re sitting quietly under your control instead of someone else’s.<\/p>\n\n\n\n
Common Mistakes Kashmiri Businesses Make<\/strong><\/h2>\n\n\n\nA few patterns show up again and again in this region specifically:<\/p>\n\n\n\n
Picking a name that’s identical to an existing hosting or handicraft business, just with the city name swapped, which creates constant customer confusion. Registering a domain through an unfamiliar, unverified reseller and losing access to it later because the account details were never properly transferred. Choosing a name in Urdu transliteration that has three or four different possible English spellings, splitting search traffic across all of them. And the most common one: registering the domain and then forgetting to renew it a year later, only to find it’s been bought by someone else within days of expiry.<\/p>\n\n\n\n
Each of these is avoidable with about twenty minutes of upfront planning.<\/p>\n\n\n\n
How a Domain Name Affects Your SEO<\/strong><\/h2>\n\n\n\nLet’s be direct about this, since a lot of guides oversell it. Your domain name itself is a small SEO factor today, not the huge one it used to be in 2010. Google’s own Search Central documentation<\/a> is clear that content quality, site structure, and genuine relevance to a searcher’s query matter far more than whatever string sits before the dot-com.<\/p>\n\n\n\nThat said, a clean, brand-matched domain name for your Kashmir business still helps indirectly. It improves click-through rates in search results because people trust a clear name more than a cluttered one. It reduces bounce because visitors immediately understand where they’ve landed. And it makes your backlink profile look more natural over time, since other sites are more likely to link to a name that’s easy to reference and credible.<\/p>\n\n\n\n
In short: don’t pick a domain hoping it’ll single-handedly rank you on page one. Pick it because it builds the trust and clarity that makes everything else you do for SEO actually work.<\/p>\n\n\n\n
Where to Register Your Domain<\/strong><\/h2>\n\n\n\nOnce you’ve settled on a name and extension, register it through a provider that’s actually familiar with Kashmir’s business landscape, not just a generic reseller panel. Local support matters more than people expect, especially when you need quick help with DNS records, email setup, or connecting your domain to hosting.<\/p>\n\n\n\n
ElySpace<\/a>, based in Srinagar, handles domain registration alongside hosting, SSL certificates, and WordPress setup for businesses across the valley, so your domain and your website end up managed in one place instead of scattered across three different logins you’ll forget about. If you want a deeper look at how local registrars compare, ElySpace also has a detailed breakdown of domain registration options in Kashmir<\/a> worth reading before you commit.<\/p>\n\n\n\nFrequently Asked Questions<\/strong><\/h2>\n\n\n\nIs .com always better than .in for a Kashmir business?<\/strong> Not always. If you’re strictly local and .com isn’t available, a clean .in domain works fine. What matters more is that the name itself is short and easy to spell.<\/p>\n\n\n\nCan I change my domain name later if I pick the wrong one?<\/strong> You can, but it costs you search rankings, backlinks, and brand recognition built under the old name. It’s far cheaper to get it right the first time than to migrate later.<\/p>\n\n\n\nShould I include my product or service in the domain name?<\/strong> Only if it doesn’t force the name to become long or awkward. A brand name that stands on its own usually ages better than one locked to a single product you might expand beyond.<\/p>\n\n\n\nHow much does domain registration typically cost?<\/strong> Standard .com and .in domains usually run a modest yearly renewal fee, varying by registrar. Always check what the renewal price is after the first year, since some providers offer a low first-year rate and a much higher renewal.<\/p>\n\n\n\nDo I need hosting and a domain from the same company?<\/strong> No, they can be separate, but managing both through one reliable provider tends to save time and reduces the chance of technical mix-ups when connecting the two.<\/p>\n\n\n\n
\n\n\n\nConclusion<\/strong><\/h2>\n\n\n\nYour domain name isn’t just an address. It’s the first line of trust you’re building with every single customer who hasn’t met you yet. Take the extra hour. Check the trademark. Say the name out loud to someone who’s never heard it. Then register it, lock in your renewal reminder, and go build the business that name deserves.<\/p>\n","protected":false},"excerpt":{"rendered":"
If you’re starting a business in Srinagar, Anantnag, Baramulla, or anywhere else in the valley, there’s a decision sitting right at the start of your journey that most people rush through in five minutes: your domain name. And that’s a shame, because the domain name for your Kashmir business is one of the few things […]<\/p>\n","protected":false},"author":12,"featured_media":5649,"comment_status":"open","ping_status":"closed","sticky":false,"template":"","format":"standard","meta":{"_acf_changed":false,"footnotes":""},"categories":[20,19,6],"tags":[848,852,847,851,833,846,850,829,330,845,165,849,835,853],"class_list":["post-5648","post","type-post","status-publish","format-standard","has-post-thumbnail","hentry","category-domain-name","category-startups","category-tutorials","tag-com-vs-in-domain","tag-business-domain-name-tips","tag-buy-domain-online","tag-choose-a-domain-name","tag-domain-name","tag-domain-name-for-your-kashmir-business","tag-domain-name-seo","tag-domain-registration","tag-elyspace","tag-kashmir-business","tag-small-business-website","tag-srinagar-business","tag-web-hosting-kashmir","tag-website-domain-registration-india"],"acf":[],"_links":{"self":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts"}],"about":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/types\/post"}],"author":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/users\/12"}],"replies":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/comments?post=5648"}],"version-history":[{"count":2,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions"}],"predecessor-version":[{"id":5662,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions\/5662"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media\/5649"}],"wp:attachment":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media?parent=5648"}],"wp:term":[{"taxonomy":"category","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/categories?post=5648"},{"taxonomy":"post_tag","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/tags?post=5648"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}
.in<\/strong> works well if your business is explicitly India-focused and the .com version of your name is already taken. It also tends to be cheaper to renew.<\/p>\n\n\n\n .co.in<\/strong> is a decent fallback, though it carries slightly less trust than .com or .in in a buyer’s mind, mainly because it’s less common.<\/p>\n\n\n\n Avoid unusual extensions like .xyz or .info for a serious business unless you have a very specific reason. They’re cheaper, but they can quietly signal “not fully established” to a first-time visitor, even if that’s unfair.<\/p>\n\n\n\n This one trips up more Kashmiri businesses than any other mistake on this list. If your ideal domain is taken, resist the urge to add a hyphen (valley-crafts.com) or swap a letter for a number (valley4crafts.com). Both create real problems.<\/p>\n\n\n\n Hyphens get lost when someone reads your domain out loud or types it from memory. Numbers create ambiguity, since nobody knows if you meant the digit “4” or the word “four.” Either choice quietly leaks traffic to a competitor who registered the cleaner version, or worse, to a scam site squatting on the confusing spelling.<\/p>\n\n\n\n If your first choice is taken, it’s almost always better to slightly rework the business name itself than to bolt on a hyphen or number to force the domain through.<\/p>\n\n\n\n This depends entirely on who you’re selling to.<\/p>\n\n\n\n If your business genuinely serves a local, geography-specific audience, a tour operator, a local delivery service, a Srinagar-based repair shop, then including “Kashmir” or your city name can actually help. Customers searching “houseboat booking Kashmir” or “AC repair Srinagar” respond well to a domain that mirrors their search.<\/p>\n\n\n\n If you’re building a brand that could eventually expand beyond the region, a Pashmina label that wants to sell in Delhi and Dubai, a software product, a design studio, lean toward a name that isn’t geographically locked in. “Kashmir” in the domain becomes a limitation the moment you outgrow it.<\/p>\n\n\n\n There’s no universally right answer here. It genuinely comes down to whether your five-year plan is regional or national.<\/p>\n\n\n\n This step gets skipped constantly, and it’s the one that causes real legal headaches later. Before you register anything, run a quick search on India’s official trademark database through the Controller General of Patents, Designs and Trade Marks<\/a> to make sure your proposed name isn’t already trademarked in your business category.<\/p>\n\n\n\n I’ve seen a small apparel brand in Kashmir spend two years building a following under a name, only to receive a legal notice because a larger company held the trademark in a different state. They had to rebrand, redo their signage, reprint packaging, and start their domain authority over. A ten-minute search at the start would have avoided all of it.<\/p>\n\n\n\n Once you’ve shortlisted a domain, check Instagram, Facebook, and WhatsApp Business for the same name before you register anything. Consistency across your domain and your social handles makes your business look established and makes it dramatically easier for customers to find and remember you.<\/p>\n\n\n\n If the exact name is taken on Instagram but the domain is free, or vice versa, that’s usually a signal to keep looking rather than settling for a mismatched setup that confuses people later.<\/p>\n\n\n\n Kashmir runs on word of mouth. A customer tells their cousin, their cousin tells a shopkeeper, and eventually someone types your domain from memory, not from a screenshot. So read your shortlisted names out loud to a few people who’ve never seen them written down. Ask them to spell it back to you.<\/p>\n\n\n\n If two or three people misspell it the same way, that’s not bad luck. That’s a naming problem, and it’s worth fixing before you commit rather than after you’ve printed a thousand business cards.<\/p>\n\n\n\n If your budget allows, register the .com, .in, and .co.in versions of your chosen name even if you only plan to actively use one. This is standard practice for a reason. It stops competitors or opportunists from registering a near-identical version of your domain and either confusing your customers or, worse, redirecting your traffic to their own site.<\/p>\n\n\n\n You don’t need to build separate websites on each one. Just point the extras to your main site, or park them, so they’re sitting quietly under your control instead of someone else’s.<\/p>\n\n\n\n A few patterns show up again and again in this region specifically:<\/p>\n\n\n\n Picking a name that’s identical to an existing hosting or handicraft business, just with the city name swapped, which creates constant customer confusion. Registering a domain through an unfamiliar, unverified reseller and losing access to it later because the account details were never properly transferred. Choosing a name in Urdu transliteration that has three or four different possible English spellings, splitting search traffic across all of them. And the most common one: registering the domain and then forgetting to renew it a year later, only to find it’s been bought by someone else within days of expiry.<\/p>\n\n\n\n Each of these is avoidable with about twenty minutes of upfront planning.<\/p>\n\n\n\n Let’s be direct about this, since a lot of guides oversell it. Your domain name itself is a small SEO factor today, not the huge one it used to be in 2010. Google’s own Search Central documentation<\/a> is clear that content quality, site structure, and genuine relevance to a searcher’s query matter far more than whatever string sits before the dot-com.<\/p>\n\n\n\n That said, a clean, brand-matched domain name for your Kashmir business still helps indirectly. It improves click-through rates in search results because people trust a clear name more than a cluttered one. It reduces bounce because visitors immediately understand where they’ve landed. And it makes your backlink profile look more natural over time, since other sites are more likely to link to a name that’s easy to reference and credible.<\/p>\n\n\n\n In short: don’t pick a domain hoping it’ll single-handedly rank you on page one. Pick it because it builds the trust and clarity that makes everything else you do for SEO actually work.<\/p>\n\n\n\n Once you’ve settled on a name and extension, register it through a provider that’s actually familiar with Kashmir’s business landscape, not just a generic reseller panel. Local support matters more than people expect, especially when you need quick help with DNS records, email setup, or connecting your domain to hosting.<\/p>\n\n\n\n ElySpace<\/a>, based in Srinagar, handles domain registration alongside hosting, SSL certificates, and WordPress setup for businesses across the valley, so your domain and your website end up managed in one place instead of scattered across three different logins you’ll forget about. If you want a deeper look at how local registrars compare, ElySpace also has a detailed breakdown of domain registration options in Kashmir<\/a> worth reading before you commit.<\/p>\n\n\n\n Is .com always better than .in for a Kashmir business?<\/strong> Not always. If you’re strictly local and .com isn’t available, a clean .in domain works fine. What matters more is that the name itself is short and easy to spell.<\/p>\n\n\n\n Can I change my domain name later if I pick the wrong one?<\/strong> You can, but it costs you search rankings, backlinks, and brand recognition built under the old name. It’s far cheaper to get it right the first time than to migrate later.<\/p>\n\n\n\n Should I include my product or service in the domain name?<\/strong> Only if it doesn’t force the name to become long or awkward. A brand name that stands on its own usually ages better than one locked to a single product you might expand beyond.<\/p>\n\n\n\n How much does domain registration typically cost?<\/strong> Standard .com and .in domains usually run a modest yearly renewal fee, varying by registrar. Always check what the renewal price is after the first year, since some providers offer a low first-year rate and a much higher renewal.<\/p>\n\n\n\n Do I need hosting and a domain from the same company?<\/strong> No, they can be separate, but managing both through one reliable provider tends to save time and reduces the chance of technical mix-ups when connecting the two.<\/p>\n\n\n\n Your domain name isn’t just an address. It’s the first line of trust you’re building with every single customer who hasn’t met you yet. Take the extra hour. Check the trademark. Say the name out loud to someone who’s never heard it. Then register it, lock in your renewal reminder, and go build the business that name deserves.<\/p>\n","protected":false},"excerpt":{"rendered":" If you’re starting a business in Srinagar, Anantnag, Baramulla, or anywhere else in the valley, there’s a decision sitting right at the start of your journey that most people rush through in five minutes: your domain name. And that’s a shame, because the domain name for your Kashmir business is one of the few things […]<\/p>\n","protected":false},"author":12,"featured_media":5649,"comment_status":"open","ping_status":"closed","sticky":false,"template":"","format":"standard","meta":{"_acf_changed":false,"footnotes":""},"categories":[20,19,6],"tags":[848,852,847,851,833,846,850,829,330,845,165,849,835,853],"class_list":["post-5648","post","type-post","status-publish","format-standard","has-post-thumbnail","hentry","category-domain-name","category-startups","category-tutorials","tag-com-vs-in-domain","tag-business-domain-name-tips","tag-buy-domain-online","tag-choose-a-domain-name","tag-domain-name","tag-domain-name-for-your-kashmir-business","tag-domain-name-seo","tag-domain-registration","tag-elyspace","tag-kashmir-business","tag-small-business-website","tag-srinagar-business","tag-web-hosting-kashmir","tag-website-domain-registration-india"],"acf":[],"_links":{"self":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts"}],"about":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/types\/post"}],"author":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/users\/12"}],"replies":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/comments?post=5648"}],"version-history":[{"count":2,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions"}],"predecessor-version":[{"id":5662,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/posts\/5648\/revisions\/5662"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media\/5649"}],"wp:attachment":[{"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/media?parent=5648"}],"wp:term":[{"taxonomy":"category","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/categories?post=5648"},{"taxonomy":"post_tag","embeddable":true,"href":"https:\/\/elyspace.com\/blog\/wp-json\/wp\/v2\/tags?post=5648"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}Avoid Hyphens, Numbers, and Confusing Spellings<\/strong><\/h2>\n\n\n\n
Should You Use “Kashmir” or Your City in the Domain?<\/strong><\/h2>\n\n\n\n
Check for Trademarks Before You Fall in Love With a Name<\/strong><\/h2>\n\n\n\n
Secure Your Social Handles Alongside the Domain<\/strong><\/h2>\n\n\n\n
Think About How It Sounds, Not Just How It Reads<\/strong><\/h2>\n\n\n\n
Register Multiple Extensions to Protect Your Brand<\/strong><\/h2>\n\n\n\n
Common Mistakes Kashmiri Businesses Make<\/strong><\/h2>\n\n\n\n
How a Domain Name Affects Your SEO<\/strong><\/h2>\n\n\n\n
Where to Register Your Domain<\/strong><\/h2>\n\n\n\n
Frequently Asked Questions<\/strong><\/h2>\n\n\n\n
\n\n\n\nConclusion<\/strong><\/h2>\n\n\n\n